| Desktop | 91/100 | ✔ |
| Mobile | 53/100 | ❗ |
| Field | Data | Result |
|---|---|---|
| Page Size | 253 KB | ✔ |
| Compression | 39 KB (-84.6%) | ✔ |
| Text/Html Ratio | 15280 / 259270 (bytes) = 5.89% | ❗ |
| Load Time | 2.11 second | ✘ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 26 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | EN-US | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | Yes | ✘ |
| Underscores in url | Yes | ✘ | Images Without ALT | 6 / 52 | ✘ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | Yes | ✘ |
| Iframe | Yes | ✘ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | No | ✘ |
| Gsafe browsing | Yes | ✔ |
| Analytics | Yes | ✔ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| wealthy | 55 | ✔ | ✔ | ✔ |
| affiliate | 51 | ✔ | ✔ | ✔ |
| have | 26 | ✘ | ✘ | ✘ |
| scam | 16 | ✔ | ✔ | ✔ |
| make | 15 | ✘ | ✘ | ✘ |
| internet | 14 | ✘ | ✘ | ✘ |
| home | 14 | ✘ | ✔ | ✘ |
| free | 14 | ✘ | ✘ | ✔ |
| review | 13 | ✔ | ✔ | ✔ |
| premium | 13 | ✘ | ✘ | ✔ |
| money | 12 | ✘ | ✘ | ✘ |
| know | 12 | ✘ | ✘ | ✘ |
| marketing | 12 | ✘ | ✘ | ✘ |
| there | 11 | ✘ | ✘ | ✘ |
| like | 11 | ✘ | ✘ | ✘ |
|
With 2.11 seconds in page load, 253 KB of page size and all other reports below, the scamreviewwealthyaffiliate.com has a SEO score of 51 out of 100 |
| Title | Scam Review Wealthy Affiliate |
| Description | Scam Review Wealthy Affiliate. What is Wealthy Affiliate?. Is wealthy affiliate a scam or the best home based business?. This will help you succeed online. |
| Keyword | a wealthy affiliate, is wealthy affiliate, in wealthy affiliate, what is wealthy affiliate, work from home, work from home jobs, legitimate work from home jobs, home business with, Scam Review Wealthy Affiliate, the wealthy affiliate scam |
| Age | 7 Years, 299 Days |
| Created | 1st-Jan-2013 |
| Updated | 25th-Dec-2019 |
| Expiry | 1st-Jan-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
|
Domain name: scamreviewwealthyaffiliate.com Registry Domain ID: 1770285569_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.namecheap.com Registrar URL: http://www.namecheap.com Updated Date: 2019-12-25T22:13:39.70Z Creation Date: 2013-01-01T15:08:21.00Z Registrar Registration Expiration Date: 2021-01-01T15:08:21.00Z Registrar: NAMECHEAP INC Registrar IANA ID: 1068 Registrar Abuse Contact Email: abuse@namecheap.com Registrar Abuse Contact Phone: +1.6613102107 Reseller: NAMECHEAP INC Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Registrant Name: WhoisGuard Protected Registrant Organization: WhoisGuard, Inc. Registrant Street: P.O. Box 0823-03411 Registrant City: Panama Registrant State/Province: Panama Registrant Postal Code: Registrant Country: PA Registrant Phone: +507.8365503 Registrant Phone Ext: Registrant Fax: +51.17057182 Registrant Fax Ext: Registrant Email: 32c3adcc02834665922be6e439e5a924.protect@whoisguard.com Registry Admin ID: Admin Name: WhoisGuard Protected Admin Organization: WhoisGuard, Inc. Admin Street: P.O. Box 0823-03411 Admin City: Panama Admin State/Province: Panama Admin Postal Code: Admin Country: PA Admin Phone: +507.8365503 Admin Phone Ext: Admin Fax: +51.17057182 Admin Fax Ext: Admin Email: 32c3adcc02834665922be6e439e5a924.protect@whoisguard.com Registry Tech ID: Tech Name: WhoisGuard Protected Tech Organization: WhoisGuard, Inc. Tech Street: P.O. Box 0823-03411 Tech City: Panama Tech State/Province: Panama Tech Postal Code: Tech Country: PA Tech Phone: +507.8365503 Tech Phone Ext: Tech Fax: +51.17057182 Tech Fax Ext: Tech Email: 32c3adcc02834665922be6e439e5a924.protect@whoisguard.com Name Server: ns1.mywahosting.com Name Server: ns2.mywahosting.com DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2020-10-27T02:38:28.10Z |
| Server IP | 54.157.250.197 |
| Server Location | United States |
| Service Provider | Amazon |
| Domains (TLD) | Status |
|---|---|
| scamreviewwealthyaffiliate.net | Available |
| scamreviewwealthyaffiliate.org | Already Registered |
| scamreviewwealthyaffiliate.biz | Available |
| scamreviewwealthyaffiliate.io | Already Registered |
| scamreviewwealthyaffiliate.info | Available |
| Domains (TLD) | Status |
|---|---|
| scamreviewealthyafiliate.com | Available |
| qcamreviewwealthyaffiliate.com | Available |
| wcamreviewwealthyaffiliate.com | Available |
| ecamreviewwealthyaffiliate.com | Available |
| zcamreviewwealthyaffiliate.com | Available |
| Waterylife.com |
| Efemerastudio.com |
| Austinichiban.com |
| Ratlerek.pl |
| Nelson-wells.com |
| Suprag.ch |
| Thegreenbuilding.com |
| Filinkov.ru |
| Jiqing789.com |
| Whyisthesky.blue |